Lineage for d1gy8b_ (1gy8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091751Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (4 species)
  7. 2091787Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [89519] (1 PDB entry)
  8. 2091789Domain d1gy8b_: 1gy8 B: [83377]
    complexed with nad, udp

Details for d1gy8b_

PDB Entry: 1gy8 (more details), 2 Å

PDB Description: trypanosoma brucei udp-galactose 4' epimerase
PDB Compounds: (B:) udp-galactose 4-epimerase

SCOPe Domain Sequences for d1gy8b_:

Sequence, based on SEQRES records: (download)

>d1gy8b_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
ydtleaimetswkfqrthpngya

Sequence, based on observed residues (ATOM records): (download)

>d1gy8b_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
vvgilrllqamllhkcdkiifsssaaifgnptmtnaepidinakkspespygeskliaer
mirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiadkrmpif
gtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrev
ievarkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrt
hpngya

SCOPe Domain Coordinates for d1gy8b_:

Click to download the PDB-style file with coordinates for d1gy8b_.
(The format of our PDB-style files is described here.)

Timeline for d1gy8b_: