SCOPe 2.05: Domain d1gxie_: 1gxi E:

Lineage for d1gxie_ (1gxi E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (1 protein)
   automatically mapped to Pfam PF02427

6. Protein Photosystem I accessory protein E (PsaE) [50095] (4 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [89302] (2 PDB entries)

8. Domain d1gxie_: 1gxi E: [83373]

Details for d1gxie_

PDB Entry: 1gxi

PDB Description: psae subunit of the photosystem i of the cyanobacterium synechocystis sp. pcc 6803

PDB Compounds: (E:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d1gxie_:

Sequence; same for both SEQRES and ATOM records:

>d1gxie_ b.34.4.2 (E:) Photosystem I accessory protein E (PsaE) {Synechocystis sp. PCC 6803 [TaxId: 1148]}
alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
aenelelvqaaak

Timeline for d1gxie_:

• d1gxie_ first appeared in SCOP 1.65
  
• d1gxie_ appears in SCOPe 2.04
  
• d1gxie_ appears in SCOPe 2.06
  
• d1gxie_ appears in the current release, SCOPe 2.08