Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (29 proteins) |
Protein Cardiac myosin binding protein C, central domain [89185] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89186] (1 PDB entry) |
Domain d1gxea_: 1gxe A: [83372] |
PDB Entry: 1gxe (more details)
SCOP Domain Sequences for d1gxea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, central domain {Human (Homo sapiens)} rqeppkihldcpgripdtivvvagnklrldvpisgdpaptviwqkaitqgnkaparpapd apedtgdsdewvfdkkllcetegrvrvettkdrsiftvegaekedegvytvtvknpvged qvnltvkvid
Timeline for d1gxea_: