Lineage for d1gxea_ (1gxe A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290233Protein Cardiac myosin binding protein C, central domain [89185] (1 species)
  7. 290234Species Human (Homo sapiens) [TaxId:9606] [89186] (1 PDB entry)
  8. 290235Domain d1gxea_: 1gxe A: [83372]

Details for d1gxea_

PDB Entry: 1gxe (more details)

PDB Description: central domain of cardiac myosin binding protein c

SCOP Domain Sequences for d1gxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, central domain {Human (Homo sapiens)}
rqeppkihldcpgripdtivvvagnklrldvpisgdpaptviwqkaitqgnkaparpapd
apedtgdsdewvfdkkllcetegrvrvettkdrsiftvegaekedegvytvtvknpvged
qvnltvkvid

SCOP Domain Coordinates for d1gxea_:

Click to download the PDB-style file with coordinates for d1gxea_.
(The format of our PDB-style files is described here.)

Timeline for d1gxea_: