Class a: All alpha proteins [46456] (202 folds) |
Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) |
Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81775] (2 PDB entries) |
Domain d1gxbd1: 1gxb D:1-70 [83370] Other proteins in same PDB: d1gxba2, d1gxbb2, d1gxbc2, d1gxbd2 complexed with mg, pop |
PDB Entry: 1gxb (more details), 2.7 Å
SCOP Domain Sequences for d1gxbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxbd1 a.46.2.1 (D:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus} mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar amrelaikid
Timeline for d1gxbd1: