SCOPe 2.06: Domain d1gxbc1: 1gxb C:1-70

Lineage for d1gxbc1 (1gxb C:1-70)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [81775] (7 PDB entries)

8. Domain d1gxbc1: 1gxb C:1-70 [83368]
   Other proteins in same PDB: d1gxba2, d1gxbb2, d1gxbc2, d1gxbd2
   complexed with mg, pop

Details for d1gxbc1

PDB Entry: 1gxb, 2.7 Å

PDB Description: anthranilate phosphoribosyltransferase in complex with pyrophosphate and magnesium

PDB Compounds: (C:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1gxbc1:

Sequence; same for both SEQRES and ATOM records:

>d1gxbc1 a.46.2.1 (C:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

Timeline for d1gxbc1:

• d1gxbc1 first appeared in SCOP 1.65
  
• d1gxbc1 appears in SCOPe 2.05
  
• d1gxbc1 appears in SCOPe 2.07
  
• d1gxbc1 appears in the current release, SCOPe 2.08