Lineage for d1gxba1 (1gxb A:1-70)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770284Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 770294Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
  5. 770295Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 770296Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 770297Species Archaeon Sulfolobus solfataricus [TaxId:2287] [81775] (5 PDB entries)
  8. 770314Domain d1gxba1: 1gxb A:1-70 [83364]
    Other proteins in same PDB: d1gxba2, d1gxbb2, d1gxbc2, d1gxbd2

Details for d1gxba1

PDB Entry: 1gxb (more details), 2.65 Å

PDB Description: anthranilate phosphoribosyltransferase in complex with pyrophosphate and magnesium
PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOP Domain Sequences for d1gxba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxba1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

SCOP Domain Coordinates for d1gxba1:

Click to download the PDB-style file with coordinates for d1gxba1.
(The format of our PDB-style files is described here.)

Timeline for d1gxba1: