Class b: All beta proteins [48724] (126 folds) |
Fold b.97: Anemone pore-forming cytolysin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
Superfamily b.97.1: Anemone pore-forming cytolysin [63724] (1 family) some topological similarity to osmotin |
Family b.97.1.1: Anemone pore-forming cytolysin [63725] (2 proteins) |
Protein Sticholysin II [89268] (1 species) |
Species Carribean sea anemone (Stoichactis helianthus) [TaxId:6123] [89269] (1 PDB entry) |
Domain d1gwya_: 1gwy A: [83356] |
PDB Entry: 1gwy (more details), 1.71 Å
SCOP Domain Sequences for d1gwya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwya_ b.97.1.1 (A:) Sticholysin II {Carribean sea anemone (Stoichactis helianthus)} alagtiiagasltfqvldkvleelgkvsrkiavgidnesggtwtalnayfrsgttdvilp efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwysnwwdvkiy sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr
Timeline for d1gwya_: