Lineage for d1gwwa_ (1gww A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868464Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 1868465Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 1868466Species Cow (Bos taurus) [TaxId:9913] [64133] (22 PDB entries)
    Uniprot P14769
  8. 1868480Domain d1gwwa_: 1gww A: [83354]
    complexed with glc, mn, udp

Details for d1gwwa_

PDB Entry: 1gww (more details), 1.8 Å

PDB Description: alpha-,1,3 galactosyltransferase - alpha-d-glucose complex
PDB Compounds: (A:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d1gwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwwa_ c.68.1.9 (A:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv

SCOPe Domain Coordinates for d1gwwa_:

Click to download the PDB-style file with coordinates for d1gwwa_.
(The format of our PDB-style files is described here.)

Timeline for d1gwwa_: