Lineage for d1gwua_ (1gwu A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005402Protein Plant peroxidase [48125] (6 species)
  7. 2005405Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 2005406Domain d1gwua_: 1gwu A: [83351]
    complexed with act, ca, hem, na

Details for d1gwua_

PDB Entry: 1gwu (more details), 1.31 Å

PDB Description: recombinant horseradish peroxidase c1a ala140gly
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d1gwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpgpfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvns

SCOPe Domain Coordinates for d1gwua_:

Click to download the PDB-style file with coordinates for d1gwua_.
(The format of our PDB-style files is described here.)

Timeline for d1gwua_: