Lineage for d1gwoa_ (1gwo A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283714Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 283715Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 283716Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 283850Protein Plant peroxidase [48125] (6 species)
  7. 283853Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)
  8. 283875Domain d1gwoa_: 1gwo A: [83349]
    complexed with act, ca, hem; mutant

Details for d1gwoa_

PDB Entry: 1gwo (more details), 2.07 Å

PDB Description: recombinant horseradish peroxidase c1a ala170gln

SCOP Domain Sequences for d1gwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwoa_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpqpfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsn

SCOP Domain Coordinates for d1gwoa_:

Click to download the PDB-style file with coordinates for d1gwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gwoa_: