SCOPe 2.04: Domain d1gwma_: 1gwm A:

Lineage for d1gwma_ (1gwm A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins)

6. Protein Non-catalytic protein 1, Ncp1 [89245] (1 species)

7. Species Piromyces equi [TaxId:99929] [89246] (4 PDB entries)
   Uniprot Q9C171 337-477

8. Domain d1gwma_: 1gwm A: [83348]
   the second CBM29
   complexed with co, edo

Details for d1gwma_

PDB Entry: 1gwm, 1.15 Å

PDB Description: carbohydrate binding module family29 complexed with glucohexaose

PDB Compounds: (A:) non-catalytic protein 1

SCOPe Domain Sequences for d1gwma_:

Sequence; same for both SEQRES and ATOM records:

>d1gwma_ b.18.1.19 (A:) Non-catalytic protein 1, Ncp1 {Piromyces equi [TaxId: 99929]}
mnvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrg
gslrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdridfqdapg
ngdriwiknlvhstgsaddfvdpinlehhhhhh

Timeline for d1gwma_:

• d1gwma_ first appeared in SCOP 1.65
  
• d1gwma_ appears in SCOPe 2.03
  
• d1gwma_ appears in SCOPe 2.05
  
• d1gwma_ appears in the current release, SCOPe 2.08, called d1gwma1