Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins) |
Protein Non-catalytic protein 1, Ncp1 [89245] (1 species) |
Species Piromyces equi [TaxId:99929] [89246] (4 PDB entries) Uniprot Q9C171 337-477 |
Domain d1gwla_: 1gwl A: [83347] the second CBM29 |
PDB Entry: 1gwl (more details), 1.51 Å
SCOPe Domain Sequences for d1gwla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwla_ b.18.1.19 (A:) Non-catalytic protein 1, Ncp1 {Piromyces equi [TaxId: 99929]} nvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrgg slrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdridfqdapgn gdriwiknlvhstgsaddfvd
Timeline for d1gwla_: