Lineage for d1gwla_ (1gwl A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777626Family b.18.1.19: Family 29 carbohydrate binding module, CBM29 [89244] (2 proteins)
  6. 1777627Protein Non-catalytic protein 1, Ncp1 [89245] (1 species)
  7. 1777628Species Piromyces equi [TaxId:99929] [89246] (4 PDB entries)
    Uniprot Q9C171 337-477
  8. 1777630Domain d1gwla_: 1gwl A: [83347]
    the second CBM29

Details for d1gwla_

PDB Entry: 1gwl (more details), 1.51 Å

PDB Description: carbohydrate binding module family29 complexed with mannohexaose
PDB Compounds: (A:) non-catalytic protein 1

SCOPe Domain Sequences for d1gwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwla_ b.18.1.19 (A:) Non-catalytic protein 1, Ncp1 {Piromyces equi [TaxId: 99929]}
nvratytvifknasglpngydnwgwgctlsyyggamiinpqegkygavslkrnsgsfrgg
slrfdmknegkvkilvenseadekfevetispsdeyvtyildvdfdlpfdridfqdapgn
gdriwiknlvhstgsaddfvd

SCOPe Domain Coordinates for d1gwla_:

Click to download the PDB-style file with coordinates for d1gwla_.
(The format of our PDB-style files is described here.)

Timeline for d1gwla_: