Class a: All alpha proteins [46456] (179 folds) |
Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (13 families) |
Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63610] (3 PDB entries) |
Domain d1gw6a1: 1gw6 A:461-610 [83342] Other proteins in same PDB: d1gw6a2, d1gw6a3 complexed with act, bes, imd, yb, zn; mutant |
PDB Entry: 1gw6 (more details), 2.2 Å
SCOP Domain Sequences for d1gw6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gw6a1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens)} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d1gw6a1: