Lineage for d1gw2a_ (1gw2 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541091Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541092Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 541093Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 541238Protein Plant peroxidase [48125] (6 species)
  7. 541241Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)
  8. 541264Domain d1gw2a_: 1gw2 A: [83341]
    complexed with ca, fer, hem; mutant

Details for d1gw2a_

PDB Entry: 1gw2 (more details), 2.15 Å

PDB Description: recombinant horseradish peroxidase c1a thr171ser in complex with ferulic acid

SCOP Domain Sequences for d1gw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw2a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghsfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvnsn

SCOP Domain Coordinates for d1gw2a_:

Click to download the PDB-style file with coordinates for d1gw2a_.
(The format of our PDB-style files is described here.)

Timeline for d1gw2a_: