Lineage for d1gw2a_ (1gw2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720260Protein Plant peroxidase [48125] (6 species)
  7. 2720263Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 2720297Domain d1gw2a_: 1gw2 A: [83341]
    complexed with ca, fer, hem

Details for d1gw2a_

PDB Entry: 1gw2 (more details), 2.15 Å

PDB Description: recombinant horseradish peroxidase c1a thr171ser in complex with ferulic acid
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d1gw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw2a_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghsfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvnsn

SCOPe Domain Coordinates for d1gw2a_:

Click to download the PDB-style file with coordinates for d1gw2a_.
(The format of our PDB-style files is described here.)

Timeline for d1gw2a_: