Lineage for d1gvsa_ (1gvs A:)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (12 proteins) Protein Pentaerythritol tetranirate reductase [63900] (1 species) Species Enterobacter cloacae [TaxId:550] [63901] (9 PDB entries) 
Domain d1gvsa_: 1gvs A: [83340]
complexed with fmn, tnf
Details for d1gvsa_
PDB Entry: 1gvs (more details), 1.38 Å
PDB Description: structure of pentaerythritol tetranitrate reductase and complexed with picric acid
SCOP Domain Sequences for d1gvsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gvsa_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
sl
SCOP Domain Coordinates for d1gvsa_:
Click to download the PDB-style file with coordinates for d1gvsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gvsa_:
- d1gvsa_ is new in SCOP 1.65
- d1gvsa_ appears in SCOP 1.67
- d1gvsa_ appears in the current release, SCOPe 2.08
View in 3D