Lineage for d1gv2a2 (1gv2 A:144-190)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277522Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 277664Family a.4.1.3: Myb [46739] (4 proteins)
  6. 277669Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 277670Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 277675Domain d1gv2a2: 1gv2 A:144-190 [83336]
    repeats 2 & 3
    complexed with na

Details for d1gv2a2

PDB Entry: 1gv2 (more details), 1.68 Å

PDB Description: crystal structure of c-myb r2r3

SCOP Domain Sequences for d1gv2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmr

SCOP Domain Coordinates for d1gv2a2:

Click to download the PDB-style file with coordinates for d1gv2a2.
(The format of our PDB-style files is described here.)

Timeline for d1gv2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gv2a1