![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitotriosidase [82628] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82629] (11 PDB entries) |
![]() | Domain d1guva2: 1guv A:267-334 [83334] Other proteins in same PDB: d1guva1 complexed with edo |
PDB Entry: 1guv (more details), 2.35 Å
SCOPe Domain Sequences for d1guva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1guva2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif rdnqwv
Timeline for d1guva2: