SCOPe 2.06: Domain d1guva2: 1guv A:267-334

Lineage for d1guva2 (1guv A:267-334)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitotriosidase [82628] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries)

8. Domain d1guva2: 1guv A:267-334 [83334]
   Other proteins in same PDB: d1guva1
   complexed with edo

Details for d1guva2

PDB Entry: 1guv, 2.35 Å

PDB Description: structure of human chitotriosidase

PDB Compounds: (A:) chitotriosidase

SCOPe Domain Sequences for d1guva2:

Sequence; same for both SEQRES and ATOM records:

>d1guva2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwv

Timeline for d1guva2:

• d1guva2 first appeared in SCOP 1.65
  
• d1guva2 appears in SCOPe 2.05
  
• d1guva2 appears in SCOPe 2.07
  
• d1guva2 appears in the current release, SCOPe 2.08