Lineage for d1guva2 (1guv A:267-334)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 502014Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 502015Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 502103Protein Chitotriosidase [82628] (1 species)
  7. 502104Species Human (Homo sapiens) [TaxId:9606] [82629] (8 PDB entries)
  8. 502108Domain d1guva2: 1guv A:267-334 [83334]
    Other proteins in same PDB: d1guva1

Details for d1guva2

PDB Entry: 1guv (more details), 2.35 Å

PDB Description: structure of human chitotriosidase

SCOP Domain Sequences for d1guva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guva2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens)}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwv

SCOP Domain Coordinates for d1guva2:

Click to download the PDB-style file with coordinates for d1guva2.
(The format of our PDB-style files is described here.)

Timeline for d1guva2:

502108
d1guva2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1guva1