Lineage for d1guva1 (1guv A:22-266,A:335-387)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083294Protein Chitotriosidase [82251] (1 species)
  7. 2083295Species Human (Homo sapiens) [TaxId:9606] [82252] (10 PDB entries)
  8. 2083301Domain d1guva1: 1guv A:22-266,A:335-387 [83333]
    Other proteins in same PDB: d1guva2
    complexed with edo

Details for d1guva1

PDB Entry: 1guv (more details), 2.35 Å

PDB Description: structure of human chitotriosidase
PDB Compounds: (A:) chitotriosidase

SCOPe Domain Sequences for d1guva1:

Sequence, based on SEQRES records: (download)

>d1guva1 c.1.8.5 (A:22-266,A:335-387) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlekgtpaskli
lgmptXgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqel

Sequence, based on observed residues (ATOM records): (download)

>d1guva1 c.1.8.5 (A:22-266,A:335-387) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrsgaaaslnvdaavqqwlekgtpasklilgm
ptXgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqel

SCOPe Domain Coordinates for d1guva1:

Click to download the PDB-style file with coordinates for d1guva1.
(The format of our PDB-style files is described here.)

Timeline for d1guva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guva2