SCOP 1.67: Domain d1gudb_: 1gud B:

Lineage for d1gudb_ (1gud B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)

6. Protein D-allose-binding protein [53828] (1 species)

7. Species Escherichia coli [TaxId:562] [53829] (3 PDB entries)

8. Domain d1gudb_: 1gud B: [83327]
   complexed with zn

Details for d1gudb_

PDB Entry: 1gud, 1.7 Å

PDB Description: hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations

SCOP Domain Sequences for d1gudb_:

Sequence; same for both SEQRES and ATOM records:

>d1gudb_ c.93.1.1 (B:) D-allose-binding protein {Escherichia coli}
aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq

Timeline for d1gudb_:

• d1gudb_ first appeared in SCOP 1.65
  
• d1gudb_ appears in SCOP 1.69
  
• d1gudb_ appears in the current release, SCOPe 2.08