Lineage for d1gu7b1 (1gu7 B:23-160,B:350-386)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461986Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 461987Protein 2,4-dienoyl-CoA reductase [89309] (1 species)
  7. 461988Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries)
  8. 461990Domain d1gu7b1: 1gu7 B:23-160,B:350-386 [83323]
    Other proteins in same PDB: d1gu7a2, d1gu7b2

Details for d1gu7b1

PDB Entry: 1gu7 (more details), 1.7 Å

PDB Description: enoyl thioester reductase from candida tropicalis

SCOP Domain Sequences for d1gu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu7b1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

SCOP Domain Coordinates for d1gu7b1:

Click to download the PDB-style file with coordinates for d1gu7b1.
(The format of our PDB-style files is described here.)

Timeline for d1gu7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gu7b2