Lineage for d1gu7a2 (1gu7 A:161-349)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 476941Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (14 proteins)
    N-terminal all-beta domain defines family
  6. 476942Protein 2,4-dienoyl-CoA reductase [89517] (1 species)
  7. 476943Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (5 PDB entries)
  8. 476944Domain d1gu7a2: 1gu7 A:161-349 [83322]
    Other proteins in same PDB: d1gu7a1, d1gu7b1

Details for d1gu7a2

PDB Entry: 1gu7 (more details), 1.7 Å

PDB Description: enoyl thioester reductase from candida tropicalis

SCOP Domain Sequences for d1gu7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)}
ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv
irdrpnldevvaslkelgatqvitedqnnsrefgptikewikqsggeaklalncvggkss
tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq
iiawyeegk

SCOP Domain Coordinates for d1gu7a2:

Click to download the PDB-style file with coordinates for d1gu7a2.
(The format of our PDB-style files is described here.)

Timeline for d1gu7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gu7a1