Lineage for d1gu5a_ (1gu5 A:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 344850Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 344989Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 344990Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 345016Protein C/ebp beta [57985] (2 species)
  7. 345017Species Human (Homo sapiens) [TaxId:9606] [64590] (7 PDB entries)
  8. 345020Domain d1gu5a_: 1gu5 A: [83319]

Details for d1gu5a_

PDB Entry: 1gu5 (more details), 2.1 Å

PDB Description: crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the mim-1 promoter

SCOP Domain Sequences for d1gu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu5a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens)}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkq

SCOP Domain Coordinates for d1gu5a_:

Click to download the PDB-style file with coordinates for d1gu5a_.
(The format of our PDB-style files is described here.)

Timeline for d1gu5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gu5b_