SCOPe 2.08: Domain d1gu4b_: 1gu4 B:

Lineage for d1gu4b_ (1gu4 B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (2 families)

5. Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)

6. Protein C/ebp beta [57985] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)

8. Domain d1gu4b_: 1gu4 B: [83318]
   protein/DNA complex

Details for d1gu4b_

PDB Entry: 1gu4, 1.8 Å

PDB Description: crystal structure of c/ebpbeta bzip homodimer bound to a high affinity dna fragment

PDB Compounds: (B:) caat/enhancer binding protein beta

SCOPe Domain Sequences for d1gu4b_:

Sequence; same for both SEQRES and ATOM records:

>d1gu4b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkqlp

Timeline for d1gu4b_:

• d1gu4b_ first appeared in SCOP 1.65
  
• d1gu4b_ appears in SCOPe 2.07