Lineage for d1gu4a_ (1gu4 A:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 625902Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 625903Family h.1.3.1: Leucine zipper domain [57960] (15 proteins)
  6. 625930Protein C/ebp beta [57985] (2 species)
  7. 625931Species Human (Homo sapiens) [TaxId:9606] [64590] (8 PDB entries)
  8. 625932Domain d1gu4a_: 1gu4 A: [83317]

Details for d1gu4a_

PDB Entry: 1gu4 (more details), 1.8 Å

PDB Description: crystal structure of c/ebpbeta bzip homodimer bound to a high affinity dna fragment

SCOP Domain Sequences for d1gu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gu4a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens)}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkq

SCOP Domain Coordinates for d1gu4a_:

Click to download the PDB-style file with coordinates for d1gu4a_.
(The format of our PDB-style files is described here.)

Timeline for d1gu4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gu4b_