Lineage for d1gska3 (1gsk A:357-510)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457981Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 458299Protein Spore coat protein A, CotA [89219] (1 species)
  7. 458300Species Bacillus subtilis [TaxId:1423] [89220] (7 PDB entries)
  8. 458303Domain d1gska3: 1gsk A:357-510 [83316]

Details for d1gska3

PDB Entry: 1gsk (more details), 1.7 Å

PDB Description: crystal structure of cota, an endospore coat protein from bacillus subtilis

SCOP Domain Sequences for d1gska3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditd

SCOP Domain Coordinates for d1gska3:

Click to download the PDB-style file with coordinates for d1gska3.
(The format of our PDB-style files is described here.)

Timeline for d1gska3: