SCOPe 2.06: Domain d1gska2: 1gsk A:183-356

Lineage for d1gska2 (1gsk A:183-356)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Spore coat protein A, CotA [89219] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (13 PDB entries)
   Uniprot P07788

8. Domain d1gska2: 1gsk A:183-356 [83315]
   complexed with c1o, c2o, cu, gol

Details for d1gska2

PDB Entry: 1gsk, 1.7 Å

PDB Description: crystal structure of cota, an endospore coat protein from bacillus subtilis

PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d1gska2:

Sequence; same for both SEQRES and ATOM records:

>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

Timeline for d1gska2:

• d1gska2 first appeared in SCOP 1.65
  
• d1gska2 appears in SCOPe 2.05
  
• d1gska2 appears in SCOPe 2.07
  
• d1gska2 appears in the current release, SCOPe 2.08