![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.1: Apolipoprotein [47162] (1 family) ![]() |
![]() | Family a.24.1.1: Apolipoprotein [47163] (2 proteins) Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1 family may also include the five-helical bundle protein Apolipophorin-III |
![]() | Protein Apolipoprotein E [88703] (3 species) |
![]() | Species Human (Homo sapiens), E4 [TaxId:9606] [47169] (3 PDB entries) |
![]() | Domain d1gs9a_: 1gs9 A: [83313] |
PDB Entry: 1gs9 (more details), 1.7 Å
SCOPe Domain Sequences for d1gs9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} sgqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeq ltpvaeetrarlskelqaaqarlgadmedvrgrlvqyrgevqamlgqsteelrvrlashl rklrkrllrdaddlqkrlavyqag
Timeline for d1gs9a_: