SCOPe 2.05: Domain d1gqza2: 1gqz A:131-274

Lineage for d1gqza2 (1gqz A:131-274)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
   automatically mapped to Pfam PF01678

6. Protein Diaminopimelate epimerase [54508] (3 species)

7. Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)

8. Domain d1gqza2: 1gqz A:131-274 [83312]

Details for d1gqza2

PDB Entry: 1gqz, 1.75 Å

PDB Description: refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a

PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d1gqza2:

Sequence; same for both SEQRES and ATOM records:

>d1gqza2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

Timeline for d1gqza2:

• d1gqza2 first appeared in SCOP 1.65
  
• d1gqza2 appears in SCOPe 2.04
  
• d1gqza2 appears in SCOPe 2.06
  
• d1gqza2 appears in the current release, SCOPe 2.08