Lineage for d1gqza1 (1gqz A:1-130)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600808Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 600809Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 600810Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
  6. 600811Protein Diaminopimelate epimerase [54508] (1 species)
  7. 600812Species Haemophilus influenzae [TaxId:727] [54509] (2 PDB entries)
  8. 600813Domain d1gqza1: 1gqz A:1-130 [83311]

Details for d1gqza1

PDB Entry: 1gqz (more details), 1.75 Å

PDB Description: refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a

SCOP Domain Sequences for d1gqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqza1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipf

SCOP Domain Coordinates for d1gqza1:

Click to download the PDB-style file with coordinates for d1gqza1.
(The format of our PDB-style files is described here.)

Timeline for d1gqza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqza2