| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) ![]() has extra strand located between strands 1 and 2 |
| Family c.72.2.1: MurCDEF [53624] (4 proteins) |
| Protein UDP-N-acetylmuramate-alanine ligase MurC [82520] (2 species) |
| Species Haemophilus influenzae [TaxId:727] [89776] (4 PDB entries) |
| Domain d1gqyb3: 1gqy B:107-321 [83310] Other proteins in same PDB: d1gqya1, d1gqya2, d1gqyb1, d1gqyb2 complexed with acp, mg |
PDB Entry: 1gqy (more details), 1.8 Å
SCOP Domain Sequences for d1gqyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqyb3 c.72.2.1 (B:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvngglvksagknahlga
sryliaeadesdasflhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfygla
vmcaddpvlmelvpkvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvlln
vpgkhnalnataalavakeegianeailealadfq
Timeline for d1gqyb3: