Lineage for d1gqya3 (1gqy A:107-321)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843354Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 843531Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
    has extra strand located between strands 1 and 2
  5. 843532Family c.72.2.1: MurCDEF [53624] (4 proteins)
  6. 843537Protein UDP-N-acetylmuramate-alanine ligase MurC [82520] (2 species)
  7. 843538Species Haemophilus influenzae [TaxId:727] [89776] (4 PDB entries)
  8. 843543Domain d1gqya3: 1gqy A:107-321 [83307]
    Other proteins in same PDB: d1gqya1, d1gqya2, d1gqyb1, d1gqyb2

Details for d1gqya3

PDB Entry: 1gqy (more details), 1.8 Å

PDB Description: murc - crystal structure of the enzyme from haemophilus influenzae complexed with amppcp
PDB Compounds: (A:) udp-n-acetylmuramate-l-alanine ligase

SCOP Domain Sequences for d1gqya3:

Sequence, based on SEQRES records: (download)

>d1gqya3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvngglvksagknahlga
sryliaeadesdasflhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfygla
vmcaddpvlmelvpkvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvlln
vpgkhnalnataalavakeegianeailealadfq

Sequence, based on observed residues (ATOM records): (download)

>d1gqya3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvngglvksagknahlga
sryliaeadesdasflhlqpmvsvvtnmepddfekmkatyvkflhnlpfyglavmcaddp
vlmelvpkvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvllnvpgkhna
lnataalavakeegianeailealadfq

SCOP Domain Coordinates for d1gqya3:

Click to download the PDB-style file with coordinates for d1gqya3.
(The format of our PDB-style files is described here.)

Timeline for d1gqya3: