Lineage for d1gqya1 (1gqy A:1-106)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850409Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2850410Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2850411Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 2850412Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)
  7. 2850413Species Haemophilus influenzae [TaxId:727] [89549] (4 PDB entries)
  8. 2850418Domain d1gqya1: 1gqy A:1-106 [83305]
    Other proteins in same PDB: d1gqya2, d1gqya3, d1gqyb2, d1gqyb3
    complexed with acp, mg

Details for d1gqya1

PDB Entry: 1gqy (more details), 1.8 Å

PDB Description: murc - crystal structure of the enzyme from haemophilus influenzae complexed with amppcp
PDB Compounds: (A:) udp-n-acetylmuramate-l-alanine ligase

SCOPe Domain Sequences for d1gqya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqya1 c.5.1.1 (A:1-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
mkhsheeirkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrla
qagakiyighaeehiegasvvvvssaikddnpelvtskqkripviq

SCOPe Domain Coordinates for d1gqya1:

Click to download the PDB-style file with coordinates for d1gqya1.
(The format of our PDB-style files is described here.)

Timeline for d1gqya1: