Lineage for d1gpqb_ (1gpq B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614178Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 2614179Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
    automatically mapped to Pfam PF08816
  5. 2614180Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)
  6. 2614181Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 2614182Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
    Uniprot P45502 31-157
  8. 2614184Domain d1gpqb_: 1gpq B: [83296]
    Other proteins in same PDB: d1gpqc_, d1gpqd_
    complexed with lysozyme

Details for d1gpqb_

PDB Entry: 1gpq (more details), 1.6 Å

PDB Description: structure of ivy complexed with its target, hewl
PDB Compounds: (B:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1gpqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpqb_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
ddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphd
cgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslen
hpdgfnfr

SCOPe Domain Coordinates for d1gpqb_:

Click to download the PDB-style file with coordinates for d1gpqb_.
(The format of our PDB-style files is described here.)

Timeline for d1gpqb_: