Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily) alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet |
Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) automatically mapped to Pfam PF08816 |
Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein) |
Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species) formerly hypothetical protein YkfE |
Species Escherichia coli [TaxId:562] [89875] (2 PDB entries) Uniprot P45502 31-157 |
Domain d1gpqb_: 1gpq B: [83296] Other proteins in same PDB: d1gpqc_, d1gpqd_ complexed with lysozyme |
PDB Entry: 1gpq (more details), 1.6 Å
SCOPe Domain Sequences for d1gpqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpqb_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]} ddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphd cgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslen hpdgfnfr
Timeline for d1gpqb_: