SCOP 1.71: Domain d1gpqb_: 1gpq B:

Lineage for d1gpqb_ (1gpq B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
   alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet

4. Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family)

5. Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)

6. Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
   formerly hypothetical protein YkfE

7. Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)

8. Domain d1gpqb_: 1gpq B: [83296]
   Other proteins in same PDB: d1gpqc_, d1gpqd_
   complexed with lysozyme

Details for d1gpqb_

PDB Entry: 1gpq, 1.6 Å

PDB Description: structure of ivy complexed with its target, hewl

SCOP Domain Sequences for d1gpqb_:

Sequence; same for both SEQRES and ATOM records:

>d1gpqb_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli}
ddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphd
cgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslen
hpdgfnfr

Timeline for d1gpqb_:

• d1gpqb_ first appeared in SCOP 1.65
  
• d1gpqb_ appears in SCOP 1.69
  
• d1gpqb_ appears in SCOP 1.73
  
• d1gpqb_ appears in the current release, SCOPe 2.08