Lineage for d1gpqa_ (1gpq A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1687126Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 1687127Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
    automatically mapped to Pfam PF08816
  5. 1687128Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)
  6. 1687129Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 1687130Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
    Uniprot P45502 31-157
  8. 1687131Domain d1gpqa_: 1gpq A: [83295]
    Other proteins in same PDB: d1gpqc_, d1gpqd_
    complexed with lysozyme

Details for d1gpqa_

PDB Entry: 1gpq (more details), 1.6 Å

PDB Description: structure of ivy complexed with its target, hewl
PDB Compounds: (A:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1gpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpqa_ d.233.1.1 (A:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
ddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphd
cgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslen
hpdgfnf

SCOPe Domain Coordinates for d1gpqa_:

Click to download the PDB-style file with coordinates for d1gpqa_.
(The format of our PDB-style files is described here.)

Timeline for d1gpqa_: