Lineage for d1gpqa_ (1gpq A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616636Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 616637Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
  5. 616638Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)
  6. 616639Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 616640Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
  8. 616641Domain d1gpqa_: 1gpq A: [83295]
    Other proteins in same PDB: d1gpqc_, d1gpqd_

Details for d1gpqa_

PDB Entry: 1gpq (more details), 1.6 Å

PDB Description: structure of ivy complexed with its target, hewl

SCOP Domain Sequences for d1gpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpqa_ d.233.1.1 (A:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli}
ddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphd
cgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslen
hpdgfnf

SCOP Domain Coordinates for d1gpqa_:

Click to download the PDB-style file with coordinates for d1gpqa_.
(The format of our PDB-style files is described here.)

Timeline for d1gpqa_: