![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species) |
![]() | Species Thermococcus celer [TaxId:2264] [89986] (8 PDB entries) |
![]() | Domain d1go0a_: 1go0 A: [83293] |
PDB Entry: 1go0 (more details)
SCOPe Domain Sequences for d1go0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1go0a_ d.79.3.1 (A:) Eukaryotic ribosomal protein L30 (L30e) {Thermococcus celer [TaxId: 2264]} gsvdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgi pvyefegtsvelgtllgrphtvsalavvdpgesrilalggke
Timeline for d1go0a_: