Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId:3677] [89337] (1 PDB entry) |
Domain d1ggpb1: 1ggp B:11-140 [83286] Other proteins in same PDB: d1ggpa_ X-ray derived abrin-based sequence |
PDB Entry: 1ggp (more details), 2.7 Å
SCOPe Domain Sequences for d1ggpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} caaatvriagrdgfcadvngegqngaaiilkkcaendnqlwtlkreatirsnggclttaa aeqakagiydctqataelsaweiadngtiinpasslvlssgaanslldlgvqtnsyasaq gwrtgn
Timeline for d1ggpb1: