Lineage for d1ga2b2 (1ga2 B:457-614)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938452Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 938466Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 938496Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)
  7. 938497Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89209] (4 PDB entries)
    endoglucanase 9G
  8. 938501Domain d1ga2b2: 1ga2 B:457-614 [83284]
    Other proteins in same PDB: d1ga2a1, d1ga2b1
    complexed with acy, ca, gol, mg

Details for d1ga2b2

PDB Entry: 1ga2 (more details), 1.7 Å

PDB Description: the crystal structure of endoglucanase 9g from clostridium cellulolyticum complexed with cellobiose
PDB Compounds: (B:) endoglucanase 9g

SCOPe Domain Sequences for d1ga2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ga2b2 b.2.2.2 (B:457-614) Endo/exocellulase:cellobiose E-4, C-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}
deviikaglnstgpnyteikavvynqtgwparvtdkisfkyfmdlseivaagidplslvt
ssnysegkntkvsgvlpwdvsnnvyyvnvdltgeniypggqsacrrevqfriaapqgtty
wnpkndfsydglpttstvntvtnipvydngvkvfgnep

SCOPe Domain Coordinates for d1ga2b2:

Click to download the PDB-style file with coordinates for d1ga2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ga2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ga2b1