Lineage for d1g9ja_ (1g9j A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284240Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (6 families) (S)
  5. 284252Family a.102.1.2: Cellulases catalytic domain [48213] (7 proteins)
  6. 284294Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 284295Species Clostridium cellulolyticum [TaxId:1521] [48221] (8 PDB entries)
  8. 284300Domain d1g9ja_: 1g9j A: [83280]
    complexed with ca, cl, glc, sgc; mutant

Details for d1g9ja_

PDB Entry: 1g9j (more details), 1.9 Å

PDB Description: x-tal structure of the mutant e44q of the cellulase cel48f in complex with a thiooligosaccharide

SCOP Domain Sequences for d1g9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ja_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium cellulolyticum}
asspankvyqdrfesmyskikdpangyfseqgipyhsietlmvqapdyghvttseamsyy
mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
qvptqrlhrfwaqsefavangvyailfpd

SCOP Domain Coordinates for d1g9ja_:

Click to download the PDB-style file with coordinates for d1g9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ja_: