Lineage for d1g9ga_ (1g9g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004138Protein Processive endocellulase CelF (Cel48F) [48220] (2 species)
  7. 2004139Species Clostridium cellulolyticum [TaxId:1521] [48221] (9 PDB entries)
  8. 2004140Domain d1g9ga_: 1g9g A: [83279]
    complexed with ca, mg

Details for d1g9ga_

PDB Entry: 1g9g (more details), 1.9 Å

PDB Description: xtal-structure of the free native cellulase cel48f
PDB Compounds: (A:) cellulase cel48f

SCOPe Domain Sequences for d1g9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ga_ a.102.1.2 (A:) Processive endocellulase CelF (Cel48F) {Clostridium cellulolyticum [TaxId: 1521]}
asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttseamsyy
mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
qvptqrlhrfwaqsefavangvyailfpd

SCOPe Domain Coordinates for d1g9ga_:

Click to download the PDB-style file with coordinates for d1g9ga_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ga_: