Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins) Pfam PF00963 |
Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species) |
Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89209] (4 PDB entries) endoglucanase 9G |
Domain d1g87b2: 1g87 B:457-614 [83278] Other proteins in same PDB: d1g87a1, d1g87b1 complexed with ca, cry, edo, mg |
PDB Entry: 1g87 (more details), 1.6 Å
SCOP Domain Sequences for d1g87b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g87b2 b.2.2.2 (B:457-614) Endo/exocellulase:cellobiose E-4, C-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]} deviikaglnstgpnyteikavvynqtgwparvtdkisfkyfmdlseivaagidplslvt ssnysegkntkvsgvlpwdvsnnvyyvnvdltgeniypggqsacrrevqfriaapqgtty wnpkndfsydglpttstvntvtnipvydngvkvfgnep
Timeline for d1g87b2: