Lineage for d1g87b2 (1g87 B:457-614)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789822Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 789836Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins)
    Pfam PF00963
  6. 789864Protein Endo/exocellulase:cellobiose E-4, C-terminal domain [49394] (2 species)
  7. 789865Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89209] (4 PDB entries)
    endoglucanase 9G
  8. 789867Domain d1g87b2: 1g87 B:457-614 [83278]
    Other proteins in same PDB: d1g87a1, d1g87b1
    complexed with ca, cry, edo, mg

Details for d1g87b2

PDB Entry: 1g87 (more details), 1.6 Å

PDB Description: the crystal structure of endoglucanase 9g from clostridium cellulolyticum
PDB Compounds: (B:) endocellulase 9g

SCOP Domain Sequences for d1g87b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g87b2 b.2.2.2 (B:457-614) Endo/exocellulase:cellobiose E-4, C-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}
deviikaglnstgpnyteikavvynqtgwparvtdkisfkyfmdlseivaagidplslvt
ssnysegkntkvsgvlpwdvsnnvyyvnvdltgeniypggqsacrrevqfriaapqgtty
wnpkndfsydglpttstvntvtnipvydngvkvfgnep

SCOP Domain Coordinates for d1g87b2:

Click to download the PDB-style file with coordinates for d1g87b2.
(The format of our PDB-style files is described here.)

Timeline for d1g87b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g87b1