Lineage for d1g87a1 (1g87 A:3-456)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358916Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 358917Superfamily a.102.1: Six-hairpin glycosidases [48208] (6 families) (S)
  5. 358929Family a.102.1.2: Cellulases catalytic domain [48213] (8 proteins)
  6. 358952Protein Endo/exocellulase:cellobiose E-4, N-terminal domain [48216] (2 species)
  7. 358953Species Clostridium cellulolyticum, atcc 35319 [TaxId:1521] [89107] (4 PDB entries)
    endoglucanase 9G
  8. 358954Domain d1g87a1: 1g87 A:3-456 [83275]
    Other proteins in same PDB: d1g87a2, d1g87b2

Details for d1g87a1

PDB Entry: 1g87 (more details), 1.6 Å

PDB Description: the crystal structure of endoglucanase 9g from clostridium cellulolyticum

SCOP Domain Sequences for d1g87a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319}
tynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvkf
nlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdgg
kdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcisha
knlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnwg
keqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsytp
kglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfvv
gygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnneia
cdynagftgalakmykhsggdpipnfkaiekitn

SCOP Domain Coordinates for d1g87a1:

Click to download the PDB-style file with coordinates for d1g87a1.
(The format of our PDB-style files is described here.)

Timeline for d1g87a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g87a2