Lineage for d1g74a_ (1g74 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 301112Family b.60.1.2: Fatty acid binding protein-like [50847] (15 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 301113Protein Adipocyte lipid-binding protein, ALBP [50856] (1 species)
  7. 301114Species Mouse (Mus musculus) [TaxId:10090] [50857] (14 PDB entries)
  8. 301122Domain d1g74a_: 1g74 A: [83273]
    complexed with ola, po4; mutant

Details for d1g74a_

PDB Entry: 1g74 (more details), 1.7 Å

PDB Description: toward changing specificity: adipocyte lipid binding protein mutant, oleic acid bound form

SCOP Domain Sequences for d1g74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g74a_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus)}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeetvdgrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

SCOP Domain Coordinates for d1g74a_:

Click to download the PDB-style file with coordinates for d1g74a_.
(The format of our PDB-style files is described here.)

Timeline for d1g74a_: