Lineage for d1g6ia_ (1g6i A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004328Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48228] (2 PDB entries)
  8. 2004330Domain d1g6ia_: 1g6i A: [83272]
    complexed with ca, dmj, nag

Details for d1g6ia_

PDB Entry: 1g6i (more details), 1.59 Å

PDB Description: crystal structure of the yeast alpha-1,2-mannosidase with bound 1- deoxymannojirimycin at 1.59 a resolution
PDB Compounds: (A:) class I alpha-1,2-mannosidase

SCOPe Domain Sequences for d1g6ia_:

Sequence, based on SEQRES records: (download)

>d1g6ia_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agemdrdriesmfleswrdyskhgwgydvygpiehtshnmprgnqplgwiivdsvdtlml
mynsstlyksefeaeiqrsehwindvldfdidaevnvfettirmlggllsayhlsdvlev
gnktvylnkaidlgdrlalaflstqtgipyssinlhsgqavknhadggasstaefttlqm
efkylayltgnrtywelvervyeplyknndllntydglvpiytfpdtgkfgastirfgsr
gdsfyeyllkqyllthetlyydlyrksmegmkkhllaqskpsslwyigereqglqgqlsp
kmdhlvcfmggllasgsteglsihearrrpffsksdwdlakgitdtcyqmykqsssglap
eivvfndgnikqdgwwrssvgdffvkpldrhnlqrpetvesimfmyhlshdhkyrewgae
iatsffentcvdcndpklrrftslsdcitlptkksnnmesfwlaetlkylyilfldefdl
tkvvfnteahpfpvldeeilksqslttgwsl

Sequence, based on observed residues (ATOM records): (download)

>d1g6ia_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agemdrdriesmfleswrdyskhgwgydvygpiehtshnmprgnqplgwiivdsvdtlml
mynsstlyksefeaeiqrsehwindvldfdidaevnvfettirmlggllsayhlsdvlev
gnktvylnkaidlgdrlalaflstqtgipyssinlhsgqavknhadggasstaefttlqm
efkylayltgnrtywelvervyeplyknndllntydglvpiytfpdtgkfgastirfgsr
gdsfyeyllkqyllthetlyydlyrksmegmkkhllaqskpsslwyigereqglqgqlsp
kmdhlvcfmggllasgsteglsihearrrpffsksdwdlakgitdtcyqmykqsssglap
eivvfndgnikdgwwrssvgdffvkpldrhnlqrpetvesimfmyhlshdhkyrewgaei
atsffentcvdcndpklrrftslsdcitlptkksnnmesfwlaetlkylyilfldefdlt
kvvfnteahpfpvldeeilksqslttgwsl

SCOPe Domain Coordinates for d1g6ia_:

Click to download the PDB-style file with coordinates for d1g6ia_.
(The format of our PDB-style files is described here.)

Timeline for d1g6ia_: